Teriparatide acetate Basic information |
Application in Particular Diseases |
Product Name: | Teriparatide acetate |
Synonyms: | PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
CAS: | 52232-67-4 |
MF: | C172H278N52O47S2 |
MW: | 3890.49792 |
EINECS: | 640-978-1 |
Product Categories: | Amino Acid Derivatives ; EndocrinologyandHormones ; Peptide ; Hormones ; Other Protein/Peptide Hormones ; proteins ; Parathyroid Hormone (PTH)Peptides and Proteins ; Parathyroid Hormone Fragments ; Peptides for Cell Biology ; Peptides and Proteins ; Various Peptides ; 52232-67-4 |
Mol File: | 52232-67-4.mol |
Packing Method:
Shipping Transit could be DHL.UPSTNT EMS Fedex and so on. For mass orders,it will be delivered by air or sea. Depending on your location,please allow 1-5 business days for your order to arrive. For small order please expect 3-7 days by UPS DHL EMS, For mass order,please allow 5-8 days by Air15-30 days by Sea.
Q1:Are you trading company or manufacturer?
A1:We are chemical factory in China,So we can provide wholesale price.
Q2:How can I get the samples?
A2:We can provide you free sample for our existing products, the lead time is about 1-2 days. You just need to pay the sample delivery cost.
Q3:If the inspection result can not meet the agreement between the two sides, can you bear all the losses caused by this?
A3:Yes, we can. We guarantee that the samples provided will meet the needs of our clients and we will bear the risk of default.
Q4:How long is your delivery time?
A4:Generally it is with 5 days if the goods are in stock. According to quantity your required, the delivery time may
slightlychange.
Q5:What's your terms of payment?
A5:We can accept various payment methods, western union, T/T, BTC( bitcoin)etc.