Teriparatide can mediate bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells and enhancing osteoblast differentiation.

Teriparatide acetate Basic information

Product Name:	Teriparatide acetate
Synonyms:	PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS:	52232-67-4
MF:	C172H278N52O47S2
MW:	3890.49792
EINECS:	640-978-1

Teriparatide acetate Chemical Properties

Melting point	>205oC (dec.)
RTECS	SQ7770000
storage temp.	−20°C
solubility	DMSO (Slightly), Water (Slightly)
form	powder
color	White to Off-White

Detailed Photos

 

What is polypeptides?

The role of polypeptides
Peptide is a compound formed by the covalent connection of two or more amino acids through peptide bond, which is widely found in nature and living organisms. Peptides are one of the important material bases of life, and their functions involve all aspects of life process. With the increasingly mature peptide manufacturing technology, the past very expensive peptide products have more and more entered People's Daily life, especially in the field of cosmetics, peptides in anti-wrinkle anti-aging has become a very important active ingredient, in addition to whitening, promote hair growth, antibacterial and other aspects also played a very important role.
 

WUHAN DASEN BIOTECHNOLOGY CO,LTD.  A professional Manufacturer of  API&Pharmaceutical intermediates  in China.  We have a pharmaceutical raw material production plant and a reagent R&D center. We now have the complete product line. In addition, we have developed and produced tens of thousands of reagents. We also have the business of custom synthesis of various organic compounds as a supplement. Our goal is to survive by quality and develop by credit.

In the past two years, our products have spread over more than 30 countries in the world, Europe, South America, North America, Southeast Asia and Africa. We work with friends all over the world to develop the quality products, reasonable prices and safe and effective transportation. Product can be ordered from milligrams to tons. Meet the purchase of new and old customers. We will not let you down.

Packing & Delivery

About the package
1kg--------Packed with aluminium bags with ziplock bags inside.
10kg-------- Carton: 50cm*30mc*40cm

1. Quality
Our products meet msds safe standard and we have iso and other certificate so yan can get high quality products from our company.

2.  Price
We are the company which is the joint of trade and industry so we cao provide the competitive price and high quality product.

3. Packing
We can do according to the customers' request.

4. Transport
EMS, DHL, TNT, UPS ,FEDEX, by air, by sea
DHL express, FEDEX and EMS for quantity less than 50kg, usually called as ddu service; 
sea shipping for quantity over 500kg; and air shipping is available for 50kg above;
for high value products, please select air shipping and DHL express for safe;

5. Service
we offer specialized logistic service including export declaration,customs clearance and every detail during shipment,this makes us able to offer you one-stop service from the order to the products transported to your hand.