Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery

Model NO.
52232-67-4
Colour
White to off-White
State
Solid
Solubility
DMSO (Slightly), Water (Slightly)
Molecular Weight
3890.49792
Delivery Time
7-10dasy
Storage Condition
−20°c
Melting Point
>205oc (DEC.)
Transport Package
10vials Per Box
Specification
10vials Per Box
Trademark
Dasen
Origin
China
Reference Price
$ 36.00 - 54.00

Product Description

Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery
Product Description

Teriparatide can mediate bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells and enhancing osteoblast differentiation.
Teriparatide acetate Basic information
Product Name: Teriparatide acetate
Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS: 52232-67-4
MF: C172H278N52O47S2
MW: 3890.49792
EINECS: 640-978-1
Teriparatide acetate Chemical Properties
Melting point  >205oC (dec.)
RTECS  SQ7770000
storage temp.  −20°C
solubility  DMSO (Slightly), Water (Slightly)
form  powder
color  White to Off-White

Detailed Photos

Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery
Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery

 

What is polypeptides?
Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery
The role of polypeptides
Peptide is a compound formed by the covalent connection of two or more amino acids through peptide bond, which is widely found in nature and living organisms. Peptides are one of the important material bases of life, and their functions involve all aspects of life process. With the increasingly mature peptide manufacturing technology, the past very expensive peptide products have more and more entered People's Daily life, especially in the field of cosmetics, peptides in anti-wrinkle anti-aging has become a very important active ingredient, in addition to whitening, promote hair growth, antibacterial and other aspects also played a very important role.

 







Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery

Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery
WUHAN DASEN BIOTECHNOLOGY CO,LTD.  A professional Manufacturer of  API&Pharmaceutical intermediates  in China.  We have a pharmaceutical raw material production plant and a reagent R&D center. We now have the complete product line. In addition, we have developed and produced tens of thousands of reagents. We also have the business of custom synthesis of various organic compounds as a supplement. Our goal is to survive by quality and develop by credit.

In the past two years, our products have spread over more than 30 countries in the world, Europe, South America, North America, Southeast Asia and Africa. We work with friends all over the world to develop the quality products, reasonable prices and safe and effective transportation. Product can be ordered from milligrams to tons. Meet the purchase of new and old customers. We will not let you down.
 

 



Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery

Packing & Delivery

Selections Speed Duration Suitable for Service Cost
By Express Fast 3-10 days < 50kg Door to door High
By Air Fast 3-7 days < 50kg Airport to airport Lower than expree
By Sea Slow 7-45 days large quantity Port to port Lowest

Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)

 
About the package
1kg--------Packed with aluminium bags with ziplock bags inside.
10kg-------- Carton: 50cm*30mc*40cm

Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery

Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery

1. Quality
Our products meet msds safe standard and we have iso and other certificate so yan can get high quality products from our company.

2.  Price
We are the company which is the joint of trade and industry so we cao provide the competitive price and high quality product.

3. Packing
We can do according to the customers' request.

4. Transport
EMS, DHL, TNT, UPS ,FEDEX, by air, by sea
DHL express, FEDEX and EMS for quantity less than 50kg, usually called as ddu service; 
sea shipping for quantity over 500kg; and air shipping is available for 50kg above;
for high value products, please select air shipping and DHL express for safe;

5. Service
we offer specialized logistic service including export declaration,customs clearance and every detail during shipment,this makes us able to offer you one-stop service from the order to the products transported to your hand.

Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery

 

Order Order
Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery


Attend d fair
Chinese Supplier High Quality Teriparatide Acetate CAS 52232-67-4 Teriparatide Overseas Warehouse Storage Fast Delivery



FAQ
Qustion1: Can you provide free amples?
Yes,some samples are available for free,the freight is by you,but it can be refunded from your balance payment of first order from us.

Question2: How to check the quality before orders?
We support to sampling once we know your specification.The samples are for free,you could only afford the shipping cost.

Question 3: How to make payments?
Paid by T/T,Western Union or Bitcoin or Escrow(Alibaba)

Question 4: When the goods will be sent out?
Normally we have stocks and 5-7 days to deliver it out

Question 5: How to contact us?
Chat online by Trade-manager & Skype & Whatsapp.Of course Email is OK.

Question 6: Is it OK to print my logo on package?
Sure.Please inform and offer your Logo formally before production.

Leave Your Message

 

✉ Contact Supplier