Peptides Teriparatide Acetate CAS: 52232-67-4 for Treatment of Osteoclast

Model NO.
CAS: 52232-67-4
Colour
White
Transport Package
According to Requests
Specification
1kg 10kg 25kg 50kg
Trademark
Mirun
Origin
Shanghai
Production Capacity
500kg/Day
Reference Price
$ 3.24 - 3.60
Contact Us

Product Description

Product Description
Teriparatide acetate Basic information
Application in Particular Diseases
Product Name: Teriparatide acetate
Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
CAS: 52232-67-4
MF: C172H278N52O47S2
MW: 3890.49792
EINECS: 640-978-1
Product Categories: Amino Acid Derivatives ; EndocrinologyandHormones ; Peptide ; Hormones ; Other Protein/Peptide Hormones ; proteins ; Parathyroid Hormone (PTH)Peptides and Proteins ; Parathyroid Hormone Fragments ; Peptides for Cell Biology ; Peptides and Proteins ; Various Peptides ; 52232-67-4
Mol File: 52232-67-4.mol
 
 
Teriparatide acetate Chemical Properties
Melting point  >205oC (dec.)
RTECS  SQ7770000
storage temp.  −20°C
solubility  DMSO (Slightly), Water (Slightly)
form  powder
color  White to Off-White
CAS DataBase Reference 52232-67-4(CAS DataBase Reference)
 
Safety Information
WGK Germany  3
HS Code  2937190000
Hazardous Substances Data 52232-67-4(Hazardous Substances Data)
 
 
 
 
 

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
Detailed Photos

Peptides Teriparatide Acetate CAS: 52232-67-4 for Treatment of Osteoclast

Peptides Teriparatide Acetate CAS: 52232-67-4 for Treatment of Osteoclast Peptides Teriparatide Acetate CAS: 52232-67-4 for Treatment of Osteoclast
 
Packaging & Shipping

Packing Method:

For small samples quantity <1 kilograms , inside we use double resealable zip bags and outside with aluminium Foil
Bags. For medium quantity 1-25 kilograms, we pack them in double-layer plastic ziplock bags (inside) with aluminium foil bag(outside). Then packed in cartons or small drums as your requirement via FedEx/TNT/DHL or special channal.
For larger quantity >25 kilograms, normally we pack them in drums(normally 25KG per) with two strong PET bags.
We do supply smaller packages like 10gram/50gram per bag as your requirement. Please contact us for more details if you have any question!
Peptides Teriparatide Acetate CAS: 52232-67-4 for Treatment of Osteoclast

Peptides Teriparatide Acetate CAS: 52232-67-4 for Treatment of Osteoclast Shipping Transit could be DHL.UPSTNT EMS Fedex and so on. For mass orders,it will be delivered by air or sea. Depending on your location,please allow 1-5 business days for your order to arrive. For small order please expect 3-7 days by UPS DHL EMS, For mass order,please allow 5-8 days by Air15-30 days by Sea.
 

Our Advantages


Peptides Teriparatide Acetate CAS: 52232-67-4 for Treatment of Osteoclast Peptides Teriparatide Acetate CAS: 52232-67-4 for Treatment of Osteoclast

Company Profile

Peptides Teriparatide Acetate CAS: 52232-67-4 for Treatment of Osteoclast

Hebei Mirun Import and Export Trading Co., LTD
Hebei Mirun Import and Export Trading Co., LTD is a company mainly engaged in high quality organic intermediates and other related
products research and development and sales for the integration of high-tech enterprises. Analysis of testing equipment, our
company has advanced and complete supporting system, formed the advanced chemical synthesis can quickly meet the applicable test
to the industrialized production of personalized requirements and seriation. If you are looking for a reliable supplier,we are the
perfect choice. We are a factory located in China. Provide door to door service. We have our own shipping that are very
professional in custom clearance, you need't to do anything.
FAQ

Q1:Are you trading company or manufacturer?
A1:We are chemical factory in China,So we can provide wholesale price.

Q2:How can I get the samples?
A2:We can provide you free sample for our existing products, the lead time is about 1-2 days. You just need to pay the sample delivery cost.

Q3:If the inspection result can not meet the agreement between the two sides, can you bear all the losses caused by this?
A3:Yes, we can. We guarantee that the samples provided will meet the needs of our clients and we will bear the risk of default.

Q4:How long is your delivery time?
A4:Generally it is with 5 days if the goods are in stock. According to quantity your required, the delivery time may
slightlychange.

Q5:What's your terms of payment?
A5:We can accept various payment methods, western union, T/T, BTC( bitcoin)etc.

 

Organic Intermediate