Muscle Building Growth Hormones Ll-37 Ll37 5mg/Vials Cathelicidin Canada Warehouse Fast Delivery CAS: 154947 -66-7

Model NO.
h043
Colour
White
Transport Package
Customizable
Specification
Customizable
Trademark
baiyi
Origin
Heibeichina
HS Code
2932999099
Production Capacity
5000000/Year
Reference Price
$ 63.00 - 135.00

Product Description

Product Description

LL-37 Basic information
Product Name: LL-37
Synonyms: Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS: 154947-66-7
MF: C205H340N60O53
MW: 0
EINECS: 211-519-9
Product Categories:  
Mol File: Mol File
 
 
 
 
 

 

 

 
 
 
Muscle Building Growth Hormones Ll-37 Ll37 5mg/Vials Cathelicidin Canada Warehouse Fast Delivery CAS: 154947-66-7
Muscle Building Growth Hormones Ll-37 Ll37 5mg/Vials Cathelicidin Canada Warehouse Fast Delivery CAS: 154947-66-7
Muscle Building Growth Hormones Ll-37 Ll37 5mg/Vials Cathelicidin Canada Warehouse Fast Delivery CAS: 154947-66-7

 
 
 
Company Profile

Muscle Building Growth Hormones Ll-37 Ll37 5mg/Vials Cathelicidin Canada Warehouse Fast Delivery CAS: 154947-66-7

Our laboratry

Muscle Building Growth Hormones Ll-37 Ll37 5mg/Vials Cathelicidin Canada Warehouse Fast Delivery CAS: 154947-66-7

Packaging & Shipping

 

Muscle Building Growth Hormones Ll-37 Ll37 5mg/Vials Cathelicidin Canada Warehouse Fast Delivery CAS: 154947-66-7
Certifications

 

Muscle Building Growth Hormones Ll-37 Ll37 5mg/Vials Cathelicidin Canada Warehouse Fast Delivery CAS: 154947-66-7
Our Advantages

 

FAQ

 

Q1: Can I get a sample?
A:Yes,we welcome sample order.

Q2: What is your MOQ?
A:Our MOQ is 5g.If the customer has special requirements, we can also consider it as appropriate

Q3: Is there any discount?
A:Yes, for larger quantity, we always support with better price.

Q4: What payment terms do you accept ?
A:We'd like to accept MoneyGram, Western Union,Bitcoin,Alipay,Bank transfer.

Q5:   When can you deliver goods?
A:1-3 working days after we get your payment.

Q6:   How long will it take to get the goods?
A:Dedicated logistics:7-14 days.

Q7:   How about the shipping method?
A:We usually choose the safest shipping method according to the customer's address. We adopt double customs clearance, door-to-door transportation. We cooperate with logistics with rich transportation experience, customers do not need to worry about goods being detained, customs clearance and other issues.

Leave Your Message

 

✉ Contact Supplier