LL-37 Basic information

Product Name:	LL-37
Synonyms:	Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS:	154947-66-7
MF:	C205H340N60O53
MW:	0
EINECS:	211-519-9
Product Categories:
Mol File:	Mol File

 

 

 

 

 

 

 

 

 

 

 

Q1: Can I get a sample?
A:Yes,we welcome sample order.

Q2: What is your MOQ?
A:Our MOQ is 5g.If the customer has special requirements, we can also consider it as appropriate

Q3: Is there any discount?
A:Yes, for larger quantity, we always support with better price.

Q4: What payment terms do you accept ?
A:We'd like to accept MoneyGram, Western Union,Bitcoin,Alipay,Bank transfer.

Q5:   When can you deliver goods?
A:1-3 working days after we get your payment.

Q6:   How long will it take to get the goods?
A:Dedicated logistics:7-14 days.

Q7:   How about the shipping method?
A:We usually choose the safest shipping method according to the customer's address. We adopt double customs clearance, door-to-door transportation. We cooperate with logistics with rich transportation experience, customers do not need to worry about goods being detained, customs clearance and other issues.