LL-37 Basic information |
Product Name: | LL-37 |
Synonyms: | Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate |
CAS: | 154947-66-7 |
MF: | C205H340N60O53 |
MW: | 0 |
EINECS: | 211-519-9 |
Product Categories: | |
Mol File: | Mol File |
Packing Method:
Shipping Transit could be DHL.UPSTNT EMS Fedex and so on. For mass orders,it will be delivered by air or sea. Depending on your location,please allow 1-5 business days for your order to arrive. For small order please expect 3-7 days by UPS DHL EMS, For mass order,please allow 5-8 days by Air15-30 days by Sea.
Q1:Are you trading company or manufacturer?
A1:We are chemical factory in China,So we can provide wholesale price.
Q2:How can I get the samples?
A2:We can provide you free sample for our existing products, the lead time is about 1-2 days. You just need to pay the sample delivery cost.
Q3:If the inspection result can not meet the agreement between the two sides, can you bear all the losses caused by this?
A3:Yes, we can. We guarantee that the samples provided will meet the needs of our clients and we will bear the risk of default.
Q4:How long is your delivery time?
A4:Generally it is with 5 days if the goods are in stock. According to quantity your required, the delivery time may
slightlychange.
Q5:What's your terms of payment?
A5:We can accept various payment methods, western union, T/T, BTC( bitcoin)etc.