Hot Sale High Purity CAS 154947 -66-7 Ll-37 Pharmaceutical Intermediate Product in Factory

Model NO.
154947-66-7
Colour
White
Transport Package
25kg
Specification
25kg/bag
Trademark
Mirun
Origin
Shanghai
Production Capacity
500kg/Day
Reference Price
$ 72.00 - 81.00
Contact Us

Product Description

Product Description
 
 
LL-37 Basic information
Product Name: LL-37
Synonyms: Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS: 154947-66-7
MF: C205H340N60O53
MW: 0
EINECS: 211-519-9
Product Categories:  
Mol File: Mol File
 
 
LL-37 Chemical Properties
solubility  Water: 1 mg/ml
form  A lyophilized powder
 
Detailed Photos

Hot Sale High Purity CAS 154947-66-7 Ll-37 Pharmaceutical Intermediate Product in Factory
Hot Sale High Purity CAS 154947-66-7 Ll-37 Pharmaceutical Intermediate Product in Factory

Packaging & Shipping

Packing Method: 

For small samples quantity <1 kilograms , inside we use double resealable zip bags and outside with aluminium Foil
Bags. For medium quantity 1-25 kilograms, we pack them in double-layer plastic ziplock bags (inside) with aluminium foil bag(outside). Then packed in cartons or small drums as your requirement via FedEx/TNT/DHL or special channal. 
For larger quantity >25  kilograms,  normally we pack them in drums(normally 25KG per) with two strong PET bags.
We do supply smaller packages like 10gram/50gram per bag as your requirement. Please contact us for more details if you have any question!
Hot Sale High Purity CAS 154947-66-7 Ll-37 Pharmaceutical Intermediate Product in Factory

Hot Sale High Purity CAS 154947-66-7 Ll-37 Pharmaceutical Intermediate Product in Factory Shipping Transit could be DHL.UPSTNT EMS Fedex and so on. For mass orders,it will be delivered by air or sea. Depending on your location,please allow 1-5 business days for your order to arrive. For small order please expect 3-7 days by UPS DHL EMS, For mass order,please allow 5-8 days by Air15-30 days by Sea.
 

Our Advantages


Hot Sale High Purity CAS 154947-66-7 Ll-37 Pharmaceutical Intermediate Product in Factory Hot Sale High Purity CAS 154947-66-7 Ll-37 Pharmaceutical Intermediate Product in Factory

Company Profile

Hot Sale High Purity CAS 154947-66-7 Ll-37 Pharmaceutical Intermediate Product in Factory

Hebei Mirun Import and Export Trading Co., LTD
Hebei Mirun Import and Export Trading Co., LTD  is a company mainly engaged in high quality organic intermediates and other related
products research and development and sales for the integration of high-tech enterprises. Analysis of testing equipment, our
company has advanced and complete supporting system, formed the advanced chemical synthesis can quickly meet the applicable test
to the industrialized production of personalized requirements and seriation. If you are looking for a reliable supplier,we are the
perfect choice. We are a factory located in China. Provide door to door service. We have our own shipping that are very
professional in custom clearance, you need't to do anything.
FAQ

Q1:Are you trading company or manufacturer?
A1:We are chemical factory in China,So we can provide wholesale price.

Q2:How can I get the samples?
A2:We can provide you free sample for our existing products, the lead time is about 1-2 days. You just need to pay the sample delivery cost. 

Q3:If the inspection result can not meet the agreement between the two sides, can you bear all the losses caused by this?
A3:Yes, we can. We guarantee that the samples provided will meet the needs of our clients and we will bear the risk of default.

Q4:How long is your delivery time?  
A4:Generally it is with 5 days if the goods are in stock. According to quantity your required, the delivery time may
slightlychange. 

Q5:What's your terms of payment?  
A5:We can accept various payment methods, western union, T/T, BTC( bitcoin)etc.

 

Organic Intermediate